(No availability) 28 Days 200-Hour Yoga and Kundalini Teacher Training in Rishikesh, India

About Siddhant School of Yoga

What makes Siddhant School of Yoga unique

Yoga professionals are practising and teaching yoga still they are unable to present YOGA as the key factor to success, growth, and happiness. Modern society thinks money, power, and success are the co-factor for a better life and yoga is the only different type of postures or a therapy. So, Siddhant School of Yoga (SSY) tries to present that yoga is the ultimate solution for any kind of challenge to achieve anything and everything.

Siddhant School of Yoga believes that yoga is the best way to stay healthy as well assure success, peace, and happiness because yoga helps you to develop your strength, focus, willpower, discipline, clarity, gratitude and much more. Yes, these all qualities are essential to a person for any kind of inner growth and outer achievement. Of course, you need proper guidance, where you can learn the balance between your inner and outer world.

Siddhant School of Yoga collects some unique and best techniques from ancient Indian Yogic scriptures and presents through 200 hours yoga teacher training course so that students can practice and gets the clarity to choose their goal whether it may be as a yoga profession or any other. Siddhant School of Yoga is a yoga school with motivational attitude to guide you for proper balance and understanding in your life. The small initiative to reconnect the yoga with the current generation to create professional and creative yoga teachers.

World's First Yoga and Gratitude Practice

Whatever we have practised, whatever we are practising and whatever we will practice, all related to our ego. The ego is the cause of all problem and stops find our real happiness, peace, satisfaction, bliss in our life. If we succeed during any practice, our ego will grow and if not succeed then the ego will dominate us. In both cases, the ego will win. So there is one practice that will dissolve your ego and that practice is “Practice of GRATITUDE”. What is Gratitude? The staying of thankfulness is Gratitude. Thankfulness is the Practice and Gratitude is the Result. If you are practising and if you succeed, then express your gratitude and if you do not succeed, they also express your gratitude. Then you will always in balance. Here we are teaching a special course of 28 days practice of Gratitude extra with the 200 hrs Yoga TTC. We are the world’s first Yoga and Gratitude center in the world. Gratitude is the real essence of Yoga and how, why, all secrets will reveal during the course.

World's one of the best Pranayama Center in Rishikesh

We observed that many students are eager to Learn Ashtanga Vinyasa, Hatha Yoga, Iyengar Yoga, Bikram Yoga and so on and someone love to learn Meditation, healing but without knowing the right breathing techniques, you will not master of the practice. The core aspect of all the above is the right breathing techniques. If you do not know right breathing techniques, then you will not master over Ashtanga Yoga, Hatha Yoga. Meditation nor any healing. Pranayama is the complete solution right breathing techniques and lots more. We are one of the world’s best pranayama center will teach you the right techniques of breathing practice. Pranayama for Meditation, Pranayama for Asana, Pranayama for daily lifestyle, Pranayama for calmness of mind and lots more. The real secrets of breathing will reveal during the course only.

A smaller group of 10 students each batch

If someone has lots of students, you can not focus and give personal attention to each and every student. So for this, Siddhant School of Yoga allowing only 10 students each batch to give personal attention to each and every student.

100 days support after the Yoga Course

Another great problem of students that they could not continue their practice after the yoga course because during the course, practice with the group is easy and the teacher also pushes you to practice. After the Yoga course, no school has personally guided you to continue your practice. Siddhant School of Yoga first time builds a process of 100 days support system to help our students. If you want, our every teacher to sit with you and make your 100 days schedule on the end of the course and our support team help you to remind your daily schedule and practice after the course. Why 100 days? it’s because 100 days to maximum time to convert your practice into habits. How this 100 days can change your life, reveal during the course.

Maximum subjects cover during the course

Siddhant school of Yoga give you daily 6 classes by covering 13 subjects to in-depth knowledge of every subject, which helps to choose your favourite subject for mastery.The course includes

Hatha Yoga

Ashtanga Vinyasa

Alignment and Adjustment

Pranayama

Yogic Purification

Bandha (Lock)

Mudra (Gesture)

Meditation

Yoga Nidra & Relaxation

Yoga Philosophy

Anatomy & Physiology

Basic Ayurveda

Kundalini and Chakra Yoga

Teaching Methodology

Teaching Practice

More than a Yoga Teacher Training Course (Mantra Chanting, Pranic Science, Kundalini and Chakra, Meditation Techniques, Yoga Secrets, Five body Science, Beyond Asana & More)

The course helps to learn both Hatha Yoga and Ashtanga Vinyasa, Meditation and some secrets of Yoga its related topic including Mantra Chanting, Prana Science, Kundalini, Chakra, Five body Science and some unique breathing techniques which can change your prospectus towards Yoga.

Certifications

The 200 hours Yoga Teacher Training course is the foundation course for a Yoga Teacher. Upon completion of this yoga teacher training, students will receive a certificate recognized by Yoga Alliance, USA. Registration with Yoga Alliance provides a globally recognized credential to you.

Program

Siddhant School of Yoga collected few and effective methods for practitioners to solve their existential and practical problems to experience peace and happiness. The 200-hour yoga teacher training program covers classical yoga technique in a warm and friendly environment that will get students in a deep awareness of the spiritual essence of life.

You have five bodies: physical, mental, energy, understanding, and bliss bodies. According to the Indian yogic science, growth means the simultaneous growth of all these five bodies. This yoga training helps you to grow in a very balanced way by the help of these five bodies.

Course Syllabus

Siddhant School of Yoga is providing 6 classes daily with covering of 12 subjects. These subjects are Ashtanga Vinyasa, Hatha Yoga, Pranayama, Yogic Purification, Bandha, Mudra, meditation, mantra chanting, Yoga Nidra and relaxation, yoga philosophy, anatomy, teaching methodology, and some more topics related to your practical life, growth, and success.

Teaching practice also includes:

Curriculum

Ashtanga Vinyasa

Every aspect of Yoga has that power to experience you the height of Yoga. Ashtanga Vinyasa is one of the most profound practices in this present time for the intense practice of Standing poses, sitting poses, flow, breathing techniques and its finishing sequence. It is the very popular style of Yoga for the present generation, the sequence of Ashtanga Vinyasa designed such a way, that you can release your stress and tension and gets a healthy body, mind and the experience of bodylessness. Here in this yoga program, you will get the following:

• Ashtanga Vinyasa series 1
• Sun salutation
• Adjustment and alignment workshop
• Hip opening workshop
• Forward bending workshop
• Back bending workshop
• Twisting postures workshop
• The use of props
• Verbal and hands-on adjustment

Hatha Yoga

Hatha yoga is the most ancient and traditional form of yoga. It is one of the best yoga practices for those who want to start their yoga journey from the body. Hatha yoga originated from the sun and the moon. HA means the sun and THA mean the moon.

The original energy of Hatha yoga is the combination of the energy of the sun and moon to bring the perfect balance of energetic body and calm mind. Practising more and more asanas in Hatha yoga will purify your body and open all the nadis to flow the energy throughout the body to awaken your vital energy.

The traditional style of Hatha yoga helps you to control your mind and prepare you for practising pranayama, meditation, yoga Nidra, and mantra chanting more consciously. You can increase your patience, stability, willpower, witness capacity, awareness, and gratitude by hatha yoga under the guidance of professional and trained yoga teachers. You will get the following:

• Asanas flows
• Introduction to hatha yoga and Iyengar yoga
• Introduction to 80 various asanas in a systematic manner with description
• Primary Hatha asanas (postures)
• Sun salutation
• The art of alignment and adjustment

Pranayama (breathing techniques)

PRAN means vital energy and AYAMA means expansion. Pranayama means the expansion of vital energy. According to Indian yogic science, breathing exercises are not pranayama. When you add locks (bandha) and gesture (mudra) with a breathing exercise, it is called pranayama. Sidhant School of Yoga teaches you a lot of pranayama techniques for the different benefit for physical, mental, and spiritual growth.

Sidhant School of Yoga helps you discover your energy center which is the secret point in yogic science. Pranayama helps generate more energy from the energy center. Pranayama helps you to purify all the energy channels so that your energy can reach the different parts of the body in a balanced way.

Sidhant School of Yoga helps you understand to manage and use the energy in your body. Understanding and practice of right pranayama help you to balance your personality for complete growth in scientific way step by step. Here in this yoga program, you will get the following:

• Introduction to pranayama
• Abdominal breathing
• Thoracic breathing
• Shoulder breathing
• Yogic inhalation
• Yogic exhalation
• Yogic breathing
• Inner retention
• Outer retention
• Kapalbhati
• Alternative breathing
• NadiShodhan
• Ratio breathing
• Bhramari
• Bhastrika
• Ujjayi

Bandhas (pranic locks)

The Sanskrit word “bandha” means ‘lock’. We are practising “bandha” for opening “Sushumna Nadi” - the queen of all Nadi system. During this practice, you are redirecting your prana flow towards Sushumna Nadi for the higher yogic experience. There are four bandhas such as:

• Mula Bandha
• Uddiyana Bandha
• Jalandhara Bandha
• Maha Bandha

Mudra (yogic gesture)

Mudra is a Sanskrit word. It is translated as the gesture. It can be described as the physical, emotional, devotional, and aesthetic gesture. It is used to link the individual pranic force with the universal force. Mudra helps to alter mood, attitude, and perception. It also deepens awareness & concentration. Mudras are higher practices which lead to the awakening of the pranas, chakras, and Kundalini. Some of the mudras are:

• Janaa mudra
• Chin mudra
• Yoni mudra
• Bhairava mudra
• Bhairavi mudra
• Hridaya mudra
• Shambhavi mudra
• Nasikagra mudra
• Kaki mudra
• Yoga mudra
• Ashwini Mudra

Shatkarma (cleansing techniques)

“Shat” means ‘six’ (6) “karma” means ‘action’ Shat karma means six types of action or six groups of practice for purification. This practice helps for balancing of the physical body, mental body, and pranic body in primary label towards the proper yogic practice for balance. Shat karma helps to balance TRIDOSHA [Vata (wind), Pitta (bile), Kapha (mucus)]. According to Hatha Yoga and Ayurveda “imbalance is illness”. Out of six types of purification methods, we are presenting few as follows:

• Jalaneti
• Kapalabhati
• Sutra neti
• Aganisara
• Dhauti (Vamana)
• Trataka
• Sheetkarama Kapalabhati

Dhyan (Meditation)

“Dhyannam Nirvishayam Manah”. The state of no mind is meditation. The thoughtlessness state is meditation. Siddhant School of Yoga is ready to help you for experiencing Meditation by Indian traditional techniques from different yogic scripture. Here in this yoga TTC we are providing you with almost 8 meditation techniques which are really helpful for all category of people such as:

• Anapana meditation
• Vipassana meditation
• Kundalini meditation
• Chakra meditation
• Trataka meditation
• Third eyes meditation
• Mantra meditation
• Silent meditation

Important information regarding meditation

• What is meditation?
• Necessity of meditation
• Fruits of meditation
• Time for meditation
• Place for meditation
• Extra room for meditation
• Importance of cave for meditation
• How to start meditation
• When and where to meditate
• Posture for meditation
• Qualification for meditation
• Pranayama for meditation
• Asana for meditation

Mantra (chanting)

Mantra has its own science. “Mananattrayate iti Mantrah” means “Mantra” is that tool help to free the mind. Mantra creates a rhythmical vibration which regulates the unsteady vibrations of the sheaths of the aspirant. Sidhant School of Yoga provides different types of Mantra to you for your different benefits.

• Guru mantra
• Mahamrutyunjaya mantra
• Gayatri mantra
• Pranavajapa
• Shanti mantra

Yoga Nidra and relaxation

Yoga Nidra is a powerful technique to deal with the subconscious mind. As you know most of conscious part of your life passively controlled by the subconscious mind and dealing with the subconscious mind is very challenging but the Teachers of SSY makes it possible because of their right practice and understanding. They know how to shift you from the conscious mind to subconscious mind for a better result. Siddhant School of Yoga really helps you to understand what relaxation is and ‘what is the nature of relaxation? Relaxation is related to detachment with one’s personality step by step.

• Right relaxation technique
• Muscle relaxation practice
• Primary and intermediate level of Yoga Nidra
• Tension relaxation

Yoga Anatomy and Physiology

The definitions of the “Anatomy” are the scientific study of the structure and relationship between different body parts. Physiology can be defined as the scientific study of the function of body parts and the body (as a whole). The study of the anatomy helps us in supporting the explanations of the physiological phenomenon. Anatomy & Physiologic provides full knowledge about “What the human system is?” and “What kind of metabolic process taking place inside the system?

• Anatomy and Physiology introduction
• Introduction to human anatomy
• Practicum on the application of anatomy to yoga asana
• Biomechanics of major joints
• Applying basic anatomy to yoga practice and teaching
• The Seven Chakras
• Flexion versus extension
• Structure and function of the Spine
• Respiratory System
• Effect of Pranayama on the respiratory system
• Muscular system
• Skeletal system
• Nervous system

Yoga Philosophy

Life is not so simple on the contrary it is a puzzle with a lot of practical and complex questions. Philosophy helps to understand the root of all questions & gives the proper solution. Philosophy is not an intellectual phenomenon, it is all about the relation between your personality and consciousness. Here you will discover the difference between ‘you’ and ‘your personality’.

SSY gives you the right understanding about the different yogic aspects which is very useful for your practical life, of course, it is helpful for spiritual growth also. Here you can get the right answers related to yoga, success, and growth.

• Introduction class of yoga and balance.
• Introduction of Panch kosha.
• Panch kosha and its balance
• Introduction of Indian rich culture.
• Introduction of Indian Philosophy

Patanjali Yoga Sutra

Patanjali Yoga Sutra is one of the most profound yogic scripture in Indian yogic system. Patanjali yoga sutra is known as Astanga Yoga, Eight Limbs of Yoga and Raj yoga, discipline and it's important in yoga, Athayoganushasanam.

• What is yoga? (yogashchittavrittinirodhah)
• Kinds of verities (Pramannaviparyayavikalpanidrasmritayah)
• Abhyasa and vairagya (abhyasavairagyabhyantannirodhah)
• Supportable of yoga (shraddhaviryasmritisamadhiprajnapoorvakaitaresham)
• Obstacles of yoga (vyadhistyanasanshayapramadalasyaviratibhrantidar)
• (shanalabdhabhoomikatvanavasthitatvanichittavikshepastentarayah)
• Five klesha (avidyasmitaragadveshabhiniveshahkleshaah)
• Concept of God (kleshakarmavipakashayairaparamrishtahpurushavishesheeshvarah)
• Surrender (eeshvarapranidhanadva)
• Kriya yoga (tapahsvadhyayeshvarapranidhananikriyayogah)

8 Limbs of yoga:

• Yama (ahinsasatyasteyabrahmacharyaparigrahayamah)
• Niyama (shauchasantoshatapahsvadhyayeshvarapranidhananiniyamah)
• Asana (sthirasukhamaasanam)
• Pranayama (tasmin sati shvasaprashvasayorgativichchhedahpranayamah)
• Pratyahara (svasvavishayasanprayogechittasysvaroopanukarivendriyananpratyaharah)
• Dharana (deshabandhashchittasyadharana)
• Dhyana (tatrapratyayaikatanatadhyanam)
• Samadhi (tadevarthamatranirbhasansvaroopashoonyamivasamadhih)
• Introduction of Hatha-yogpradipika
• Introduction of Gherand Sanhita
• Introduction of Bhagwat Geeta

Teaching Methodology

For a yoga teacher, teaching methodology is as important as practising yoga. Sharing is one of the fundamental qualities of a yoga teacher, teaching methodology is all about proper sharing to society. Practice yoga may be easy but to teach yoga is very challenging for a yoga teacher. Here in this residential yoga courses, Siddhant School of Yoga presents some unique and practical teaching methods for yoga students, which can help them to teach yoga after course such as:

• Class planning and preparation
• Modification of class according to age, gender, and physical problems
• Posture analysis
• Qualities of a good teacher
• Setting up a proper environment for class
• The art of teaching yoga

Teaching Practice

Teaching is a part of yoga course. In this segment, students are given an opportunity to take different classes to present themselves as a yoga teacher.

• Introduction
• Class management and lesson planning
• Demonstration and clear instructions
• Proper alignment and adjustment
• Sources of teaching methods
• Yoga and yogic practices

Recommended Books

Reading is one of the best habits of a practitioner. By reading you can enhance the capacity of your brain and develop your understanding.

• Light on Yoga: The Classic Guide to Yoga by BKS Iyengar
• Yoga Mala by K. Pattabhi Jois
• Asana Pranayama Mudra Bandha
• The Power of Now by Eckhart Tolle
• Four Chapter on Freedom (Patanjali Yoga Sutra)

Schedule

• 05:30 wake up time
• 06:00 Herbal Tea
• 06:30 Yogic Purification/ Omm Chanting
• 07:00 Pranayama / Bandha / Mudra
• 08:00 Hatha Yoga / Alignment & Adjustment
• 09:30 Breakfast
• 11:00 Yoga philosophy / Yoga Nidra & Relaxation
• 13:00 Lunch and rest
• 14:30 Anatomy and physiology / Mantra Chanting
• 15:30 Teatime
• 16:00 Meditation
• 17.30 Ashtanga Vinyasa
• 19:15 Dinner
• 08:15 Study time
• 10:00 Lights off

You will enjoy excursions to tourist destinations in and around Rishikesh. The activities include sightseeing in Rishikesh and near by places, workshop near Ganga Bank, visiting the Sun Rising and meditating on nature.

Rishikesh is the yoga capital of the world and its famous for its natural beauty and the holy mother River Ganga. It is the safe place for tourists and locals alike. Locals are used to foreigners and things, such as communication, are a lot easier here than other parts of India. Just practice your usual safety precautions and always keep track of your belongings.

If you are a first-time visitor to India, you may experience culture shock from just how different India is from other parts of the world. Be aware that it may be very emotionally overwhelming upon arriving in India, especially if you are beginning your journey in a big city like Delhi. Just know that Rishikesh is a very peaceful and relaxed place in India compared to other large cities like Delhi or Mumbai.

+−

Eating can also be considered a proper practice in which you seek for universal balance. You have to develop mindful eating practice so Siddhant School of Yoga can provide a ground that truly supports your personality and yoga practice.

You will get three (breakfast, lunch, and dinner) meals per day and all meals are vegetarian, nutritious, healthy, and with a balanced diet. A nourishing diet with fruits, vegetables, Indian herbs is added to the meal plan on an everyday basis. You will also get proper yogic food and tea or coffee (three times) during the course.

• 200-hour certificate recognized by Yoga Alliance
• 27 nights' accommodation
• 28 days' yoga course
• Single private room Bathroom with hot and cold water
• Daily vegetarian breakfast, lunch, and dinner
• Filtered water
• Daily tea 3 times
• Free Wi-Fi connection
• Free use of yoga tools during yoga course
• Free study materials
• Free yoga mat
• Free yogic purification kit
• Local sightseeing exploration
• 100 days support after completion of yoga course
• Free Airport pick up from Dehradun Airport
• 1 cooking class
• 1 Ayurvedic massage

• Airfares
• Airport transfers
• Additional meals and activities
• Personal expenses

• A reservation requires a deposit of 20% of the total price.
• The deposit is non-refundable, if the booking is cancelled.
• The rest of the payment should be paid on arrival.